RetrogeneDB ID: | retro_btau_269 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 1:93601621..93601962(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ANAPC15 | ||
| Ensembl ID: | ENSBTAG00000002999 | ||
| Aliases: | ANAPC15, APC15, C15H11orf51 | ||
| Description: | Anaphase-promoting complex subunit 15 [Source:UniProtKB/Swiss-Prot;Acc:Q3SZ31] |
| Percent Identity: | 53.66 % |
| Parental protein coverage: | 99.17 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 3 |
| Parental | MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPI-GKPASEHYDDEEEED |
| MSTL..SL...VTETLW.NLD....EET......QQH.AWLQSI..K..NLV...GK..S.HYD....E. | |
| Retrocopy | MSTLLSSLLSHVTETLWLNLDGSWMEETGTAAG-QQHEAWLQSITRKNRNLVFL>GKLDSDHYD--KKEK |
| Parental | EDDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGE-VNEVDM-EGNEQDQDQWM |
| ED.D......SED.E...DM.EMNDYNE.PDDGE...E.D..E.N.....QWM | |
| Retrocopy | ED*DGQERGHSEDSE---DMGEMNDYNE*PDDGE<IIETDT<ESNRKN*GQWM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 8 .36 RPM |
| ERP005899_muscle | 0 .00 RPM | 19 .37 RPM |
| SRP017611_brain | 0 .00 RPM | 16 .81 RPM |
| SRP017611_kidney | 0 .00 RPM | 14 .82 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .36 RPM |
| SRP030211_testis | 0 .00 RPM | 35 .66 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1999 |
| Pongo abelii | retro_pabe_2388 |
| Equus caballus | retro_ecab_470 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010843 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002999 | 2 retrocopies |
retro_btau_252, retro_btau_269 ,
|
| Canis familiaris | ENSCAFG00000005781 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021041 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005321 | 1 retrocopy | |
| Homo sapiens | ENSG00000110200 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012501 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014120 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016270 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010260 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017234 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003646 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015797 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000004171 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000014179 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010773 | 1 retrocopy |