RetrogeneDB ID: | retro_mmul_2551 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | X:6453917..6454244(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.17861 | ||
| Ensembl ID: | ENSMMUG00000016270 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.24 % |
| Parental protein coverage: | 90.08 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | TETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSED |
| TETLWFNLDRPCVEETELQQQE.QH..WLQSIAEKDNNLVPIGK.ASEHY.DEEEEDDED.E.SEED.ED | |
| Retrocopy | TETLWFNLDRPCVEETELQQQE*QH*TWLQSIAEKDNNLVPIGKSASEHYVDEEEEDDEDNEGSEEDLED |
| Parental | DEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI |
| DE.MQDM..MNDYN.SPDD.E.NEVDMEG.EQDQDQWMI | |
| Retrocopy | DEGMQDMNKMNDYN*SPDDREINEVDMEGKEQDQDQWMI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 13 .00 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .04 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .75 RPM |
| SRP007412_heart | 0 .00 RPM | 20 .96 RPM |
| SRP007412_kidney | 0 .00 RPM | 22 .07 RPM |
| SRP007412_liver | 0 .00 RPM | 8 .35 RPM |
| SRP007412_testis | 0 .00 RPM | 17 .04 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4780 |
| Gorilla gorilla | retro_ggor_2977 |
| Pongo abelii | retro_pabe_3720 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010843 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002999 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000005781 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021041 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005321 | 1 retrocopy | |
| Homo sapiens | ENSG00000110200 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000014120 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016270 | 1 retrocopy |
retro_mmul_2551 ,
|
| Mustela putorius furo | ENSMPUG00000010260 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017234 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003646 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015797 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000004171 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000014179 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010773 | 1 retrocopy |