RetrogeneDB ID: | retro_nleu_1151 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397283.1:10587096..10587348(+) | ||
| Located in intron of: | ENSNLEG00000012740 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1G1 | ||
| Ensembl ID: | ENSNLEG00000016833 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.13 % |
| Parental protein coverage: | 76.27 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | RAAEKVSEARKR-KNRRLKQAKEEAQAEIEQYRLQRE-KEFKAKEAAALGSRGSCSTEVEKETQEKMTIL |
| R....VSE.....KNRR.KQAK...Q.EIEQY.LQRE.KEFKAKEAAAL.S.GSCST.VE.ETQE..TI. | |
| Retrocopy | RLLKRVSETCSE<KNRREKQAKAAVQGEIEQYCLQRE>KEFKAKEAAALRSQGSCSTKVE-ETQENRTIW |
| Parental | QTYFRQNRDEVLDNLLAFVCDI |
| ...FRQ.R.EVL....AF.CDI | |
| Retrocopy | K-QFRQKRGEVL----AFFCDI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020461 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008083 | 15 retrocopies | |
| Dipodomys ordii | ENSDORG00000014850 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000008080 | 3 retrocopies | |
| Homo sapiens | ENSG00000136888 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004011 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000013437 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008657 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000004899 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019574 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000039105 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016833 | 2 retrocopies |
retro_nleu_1151 , retro_nleu_3045,
|
| Pan troglodytes | ENSPTRG00000021290 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000015857 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000010985 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011474 | 3 retrocopies |