RetrogeneDB ID: | retro_itri_1235 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393409.1:3512311..3512532(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1G1 | ||
| Ensembl ID: | ENSSTOG00000015857 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864] |
| Percent Identity: | 64.94 % |
| Parental protein coverage: | 64.41 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MASQSQGIQQLLQAEKRAAEKVSEARKRKN-RRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSC |
| ..S.SQG.QQLLQAEK..AE.V..A.K.KN..RLKQA.E...A.I.Q..LQREKE.KAKE..ALGSHGSC | |
| Retrocopy | VTSRSQGTQQLLQAEKEVAE-VFKASKLKN<HRLKQATE-TRANIKQCHLQREKELKAKEVVALGSHGSC |
| Parental | STEVEKE |
| S...EKE | |
| Retrocopy | SSKEEKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020461 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008083 | 15 retrocopies | |
| Dipodomys ordii | ENSDORG00000014850 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000008080 | 3 retrocopies | |
| Homo sapiens | ENSG00000136888 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004011 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000013437 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008657 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000004899 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019574 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000039105 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016833 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000021290 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000015857 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000010985 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011474 | 3 retrocopies |