RetrogeneDB ID: | retro_mmus_322 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:58428454..58428662(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rpl37a | ||
| Ensembl ID: | ENSMUSG00000046330 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:98068] |
| Percent Identity: | 57.75 % |
| Parental protein coverage: | 76.09 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | ASLRKMVKKIEISQHAKYTCSFCG-KTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKE |
| .S.RKMV..IE..QHAKY.C.FCG.K.K.K..AVGIWHCGS.....A.G.W.Y.TT.AV......RRL.E | |
| Retrocopy | SSFRKMVENIEVKQHAKYACTFCG>KAKIKK*AVGIWHCGSHREMQADGTWIY-TTTAVAA*PVTRRLEE |
| Parental | L |
| L | |
| Retrocopy | L |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .26 RPM | 32 .45 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 19 .41 RPM |
| SRP007412_heart | 0 .06 RPM | 39 .16 RPM |
| SRP007412_kidney | 0 .00 RPM | 39 .62 RPM |
| SRP007412_liver | 0 .00 RPM | 35 .64 RPM |
| SRP007412_testis | 0 .00 RPM | 37 .83 RPM |