RetrogeneDB ID: | retro_mdom_350 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:257592978..257593173(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL37A | ||
| Ensembl ID: | ENSMODG00000025485 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37a [Source:HGNC Symbol;Acc:10348] |
| Percent Identity: | 64.62 % |
| Parental protein coverage: | 70.65 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | KKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD |
| .KI.IS...KYT.S.C.K...KR.A.GIWHC.SCM..V.GG.W.Y..TS.V.VKSAIRRLKELKD | |
| Retrocopy | EKIVIS*NIKYTYSLCRKA*RKRQAMGIWHCDSCMTIVVGGTWIYGATSIVMVKSAIRRLKELKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |