RetrogeneDB ID: | retro_mmul_2236 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:70468030..70468258(-) | ||
| Located in intron of: | ENSMMUG00000019526 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NEDD8 | ||
| Ensembl ID: | ENSMMUG00000029409 | ||
| Aliases: | None | ||
| Description: | NEDD8 [Source:RefSeq peptide;Acc:NP_001253817] |
| Percent Identity: | 93.42 % |
| Parental protein coverage: | 93.83 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | KTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRG |
| .TLTGKE.EID.EPTDKV.RIKERVEEKEGIPPQQQRLIYSGKQ.NDEKTAADYKILGGSVLHLVLALRG | |
| Retrocopy | QTLTGKETEIDTEPTDKV*RIKERVEEKEGIPPQQQRLIYSGKQTNDEKTAADYKILGGSVLHLVLALRG |
| Parental | GGGLRQ |
| GGGLRQ | |
| Retrocopy | GGGLRQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 4 .15 RPM | 51 .88 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 76 .32 RPM |
| SRP007412_cerebellum | 3 .62 RPM | 32 .93 RPM |
| SRP007412_heart | 2 .94 RPM | 40 .34 RPM |
| SRP007412_kidney | 3 .99 RPM | 35 .68 RPM |
| SRP007412_liver | 2 .73 RPM | 24 .50 RPM |
| SRP007412_testis | 3 .05 RPM | 35 .54 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
| Homo sapiens | ENSG00000129559 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy |
retro_mmul_2236 ,
|
| Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |