RetrogeneDB ID: | retro_eeur_43 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | GeneScaffold_2543:38759..38974(-) | ||
| Located in intron of: | ENSEEUG00000014042 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NEDD8 | ||
| Ensembl ID: | ENSEEUG00000011640 | ||
| Aliases: | None | ||
| Description: | neural precursor cell expressed, developmentally down-regulated 8 [Source:HGNC Symbol;Acc:7732] |
| Percent Identity: | 52.05 % |
| Parental protein coverage: | 88.89 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | VKTLTGKEIEIDIEPTDKVERIKERVEEK-EGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLAL |
| .KTL.GK.I....EP.D..E..K.......EGI.P.QQRLI..GKQ..D..T..DYKI...S.L.LVL.L | |
| Retrocopy | MKTLIGKTITLEVEPSDTIENVKAKIQDR<EGITPDQQRLIFAGKQLEDGCTVSDYKIQKESTLYLVLCL |
| Parental | RGG |
| RGG | |
| Retrocopy | RGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 39 .80 RPM |
| SRP017611_kidney | 0 .00 RPM | 60 .39 RPM |
| SRP017611_liver | 0 .00 RPM | 27 .49 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies |
retro_eeur_165, retro_eeur_43 ,
|
| Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
| Homo sapiens | ENSG00000129559 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |