RetrogeneDB ID: | retro_btau_89 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 9:69015441..69015687(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSBTAG00000021446 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NEDD8 | ||
| Ensembl ID: | ENSBTAG00000038842 | ||
| Aliases: | None | ||
| Description: | NEDD8 precursor [Source:RefSeq peptide;Acc:NP_777189] |
| Percent Identity: | 77.5 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | VISIKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVL |
| .I..KTLT.KEIEID.EPTDKVE.IKERV.EKEGIPP.QQRL.YSG.Q.N..KT..DY..L.GSVLHLVL | |
| Retrocopy | LIKVKTLTRKEIEIDTEPTDKVEQIKERVKEKEGIPPEQQRLTYSGRQINVKKTSTDYRLLSGSVLHLVL |
| Parental | ALRGGGGLRQ |
| ALRGGGGLRQ | |
| Retrocopy | ALRGGGGLRQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 10 .24 RPM |
| ERP005899_muscle | 0 .05 RPM | 24 .65 RPM |
| SRP017611_brain | 0 .00 RPM | 27 .45 RPM |
| SRP017611_kidney | 0 .12 RPM | 31 .77 RPM |
| SRP017611_liver | 0 .00 RPM | 14 .57 RPM |
| SRP030211_testis | 0 .00 RPM | 33 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038842 | 1 retrocopy |
retro_btau_89 ,
|
| Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
| Homo sapiens | ENSG00000129559 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |