RetrogeneDB ID: | retro_mdom_1681 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 6:174770131..174770354(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NEDD8 | ||
| Ensembl ID: | ENSMODG00000003254 | ||
| Aliases: | None | ||
| Description: | neural precursor cell expressed, developmentally down-regulated 8 [Source:HGNC Symbol;Acc:7732] |
| Percent Identity: | 73.33 % |
| Parental protein coverage: | 91.36 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | LTGKEIE-IDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKIQGGSVLHLVLALRGG |
| LTGKEIE.ID.E...KVE.IKERVEEKEGIP...Q.LIYSGKQM.D.KT..D.KIQG.SVLHL..AL.GG | |
| Retrocopy | LTGKEIE>IDTESIGKVEWIKERVEEKEGIPL*PQQLIYSGKQMKD*KTGSDSKIQGHSVLHLLFALCGG |
| Parental | GGLGR |
| G.LGR | |
| Retrocopy | GDLGR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 204 .54 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 255 .94 RPM |
| SRP007412_heart | 0 .00 RPM | 155 .49 RPM |
| SRP007412_kidney | 0 .00 RPM | 160 .65 RPM |
| SRP007412_liver | 0 .00 RPM | 129 .40 RPM |
| SRP007412_testis | 0 .00 RPM | 167 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
| Homo sapiens | ENSG00000129559 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy |
retro_mdom_1681 ,
|
| Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |