RetrogeneDB ID: | retro_mmul_2099 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 6:105238737..105238977(-) | ||
| Located in intron of: | ENSMMUG00000013582 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM2 | ||
| Ensembl ID: | ENSMMUG00000006832 | ||
| Aliases: | None | ||
| Description: | U6 snRNA-associated Sm-like protein LSm2 [Source:RefSeq peptide;Acc:NP_001247614] |
| Percent Identity: | 86.25 % |
| Parental protein coverage: | 85.11 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | VVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDA |
| VVELKNDLSICG.LHSVDQYLNIKLT.ISVTDPEKYPHMLSVKNC.I.GSVV.Y.QLPADE...QLLQDA | |
| Retrocopy | VVELKNDLSICGMLHSVDQYLNIKLTNISVTDPEKYPHMLSVKNCLIQGSVVPYMQLPADEIHKQLLQDA |
| Parental | ARKEALQQKQ |
| ARKE.L.QKQ | |
| Retrocopy | ARKEPLPQKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .48 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 6 .58 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .13 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .89 RPM |
| SRP007412_kidney | 0 .12 RPM | 6 .46 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .24 RPM |
| SRP007412_testis | 0 .00 RPM | 14 .51 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3361 |
| Pan troglodytes | retro_ptro_2284 |
| Pongo abelii | retro_pabe_2765 |
| Callithrix jacchus | retro_cjac_1828 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002601 | 2 retrocopies | |
| Felis catus | ENSFCAG00000004511 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006832 | 3 retrocopies |
retro_mmul_1389, retro_mmul_1875, retro_mmul_2099 ,
|
| Mus musculus | ENSMUSG00000007050 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006371 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003668 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016461 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017986 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000048725 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013144 | 1 retrocopy |