RetrogeneDB ID: | retro_cjac_1828 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 2:98193032..98193264(+) | ||
| Located in intron of: | ENSCJAG00000016120 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM2 | ||
| Ensembl ID: | ENSCJAG00000002601 | ||
| Aliases: | None | ||
| Description: | LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:13940] |
| Percent Identity: | 84.62 % |
| Parental protein coverage: | 81.05 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | FYSFFKSLVGKDVVVELKNDLSICGTLHSVDQ-YLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQ |
| FY.F.KSLVGKDVVVELKNDLSICGTLHSVDQ.YL.I.LTDI.VTDPEKYPH.LSVKNCFI.GS.VRYVQ | |
| Retrocopy | FYCFLKSLVGKDVVVELKNDLSICGTLHSVDQ>YLSIRLTDIIVTDPEKYPHILSVKNCFILGSMVRYVQ |
| Parental | LPADEVDT |
| LPA..V.T | |
| Retrocopy | LPANKVHT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .13 RPM | 5 .75 RPM |
| SRP051959_heart | 0 .16 RPM | 4 .00 RPM |
| SRP051959_kidney | 0 .24 RPM | 4 .77 RPM |
| SRP051959_liver | 0 .04 RPM | 3 .66 RPM |
| SRP051959_lung | 0 .28 RPM | 5 .24 RPM |
| SRP051959_lymph_node | 0 .11 RPM | 8 .47 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 4 .91 RPM |
| SRP051959_spleen | 0 .08 RPM | 6 .53 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3361 |
| Pan troglodytes | retro_ptro_2284 |
| Pongo abelii | retro_pabe_2765 |
| Macaca mulatta | retro_mmul_2099 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002601 | 2 retrocopies |
retro_cjac_1828 , retro_cjac_2088,
|
| Felis catus | ENSFCAG00000004511 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006832 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000007050 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006371 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003668 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016461 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017986 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000048725 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013144 | 1 retrocopy |