RetrogeneDB ID: | retro_mmul_1253 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 16:30654785..30654995(-) | ||
| Located in intron of: | ENSMMUG00000005551 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.4204 | ||
| Ensembl ID: | ENSMMUG00000014990 | ||
| Aliases: | None | ||
| Description: | ubiquitin-fold modifier 1 [Source:RefSeq peptide;Acc:NP_001244854] |
| Percent Identity: | 85.71 % |
| Parental protein coverage: | 82.35 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | LPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC |
| .PYKVL..PESTPFTAVLKFAAEEFKV.AATSA.ITND.IGIN.AQTAGNVFLK.G.ELRIIPRD.VGSC | |
| Retrocopy | MPYKVLCIPESTPFTAVLKFAAEEFKVHAATSAVITNDRIGINLAQTAGNVFLKQGLELRIIPRDHVGSC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .15 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .44 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .46 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .83 RPM |
| SRP007412_kidney | 0 .00 RPM | 10 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .30 RPM |
| SRP007412_testis | 0 .00 RPM | 2 .30 RPM |