RetrogeneDB ID: | retro_ecab_293 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 14:23365029..23365227(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UFM1 | ||
| Ensembl ID: | ENSECAG00000014564 | ||
| Aliases: | None | ||
| Description: | ubiquitin-fold modifier 1 [Source:HGNC Symbol;Acc:20597] |
| Percent Identity: | 81.82 % |
| Parental protein coverage: | 77.65 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MSKVSFKITLTSDPRLPYKVLSVPEGTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNV |
| M.KVSFKITLT.D..LPYKVL.VP...PFT.VLKFAAEEFKVPAATS.IITNDG.GINP.QTAGNV | |
| Retrocopy | MWKVSFKITLTLDLPLPYKVLRVPKRSPFTTVLKFAAEEFKVPAATSTIITNDGMGINPVQTAGNV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 3 .66 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 5 .76 RPM |
| SRP021940_embryo | 0 .00 RPM | 11 .48 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 9 .00 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 6 .92 RPM |
| SRP021940_testis | 0 .00 RPM | 7 .67 RPM |