RetrogeneDB ID: | retro_mluc_1263 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429810:1929774..1930193(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NUDT5 | ||
| Ensembl ID: | ENSMLUG00000010453 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 54.79 % |
| Parental protein coverage: | 68.93 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 4 |
| Parental | CIILVKQFRPPMGSYCLEFP-AGLIDDNESPEAAALRELEEETG-YKGDVAECSPATCMDPGLSNCTTHI |
| CI...K...PP.G...LE.P.A.....N..PE.AA.R....E.....GDVAE.SPA...DPGLSNCTTHI | |
| Retrocopy | CIHPAKRL*PPAGGCRLEAP<AAVTGGNQHPETAAPRKVKGESN<HRGDVAE-SPAVGVDPGLSNCTTHI |
| Parental | VTVTINGDEAENVRPKPNPGDGEFVEVLSLPKNDLMKRL-EALVTEEHLTVDARVYS-YALALKHANTKP |
| .T.T..GDE.EN.RPKP.PG.GEF..V.SLP.N.L..RL..A...E.HLT...RVYS..AL.LKH...K. | |
| Retrocopy | MTGTVSGDETENGRPKPKPGAGEFGKVISLPENHLLQRL<GAPGAEDHLTAGVRVYS<HALVLKHTDMKF |
| Parental | FEVPFL |
| F.VPFL | |
| Retrocopy | F*VPFL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019509 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000004794 | 2 retrocopies | |
| Equus caballus | ENSECAG00000023658 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006403 | 1 retrocopy | |
| Felis catus | ENSFCAG00000025093 | 1 retrocopy | |
| Homo sapiens | ENSG00000165609 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006325 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012052 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010453 | 2 retrocopies |
retro_mluc_1263 , retro_mluc_2073,
|
| Macaca mulatta | ENSMMUG00000017141 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012298 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009308 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005816 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002091 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000002294 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017741 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011113 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007394 | 2 retrocopies |