RetrogeneDB ID: | retro_ggor_2415 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 6:37085674..37086040(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NUDT5 | ||
| Ensembl ID: | ENSGGOG00000006325 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 89.34 % |
| Parental protein coverage: | 54.95 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | LIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEF |
| LIDDGETP.AAAL.ELEEETG.KGD.AECSP.VCMDPGLSN.T.HIVTV.INGDDAEN.RPKPKPGDGEF | |
| Retrocopy | LIDDGETPGAAALWELEEETGHKGDVAECSPVVCMDPGLSNYTTHIVTVIINGDDAENVRPKPKPGDGEF |
| Parental | VEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
| VEVISLPKNDLLQ.LDALVAE.HLTVDARVYS.ALALKHANAKPFEVP.LKF | |
| Retrocopy | VEVISLPKNDLLQGLDALVAEKHLTVDARVYSHALALKHANAKPFEVPVLKF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .19 RPM | 6 .95 RPM |
| SRP007412_cerebellum | 0 .08 RPM | 8 .04 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .94 RPM |
| SRP007412_kidney | 0 .04 RPM | 14 .11 RPM |
| SRP007412_liver | 0 .11 RPM | 13 .72 RPM |
| SRP007412_testis | 0 .31 RPM | 11 .71 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3580 |
| Pan troglodytes | retro_ptro_2427 |
| Pongo abelii | retro_pabe_2949 |
| Macaca mulatta | retro_mmul_1828 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019509 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000004794 | 2 retrocopies | |
| Equus caballus | ENSECAG00000023658 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006403 | 1 retrocopy | |
| Felis catus | ENSFCAG00000025093 | 1 retrocopy | |
| Homo sapiens | ENSG00000165609 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006325 | 1 retrocopy |
retro_ggor_2415 ,
|
| Loxodonta africana | ENSLAFG00000012052 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010453 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000017141 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012298 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009308 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005816 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002091 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000002294 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017741 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011113 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007394 | 2 retrocopies |