RetrogeneDB ID: | retro_mdom_1720 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 7:72132909..72133150(+) | ||
| Located in intron of: | ENSMODG00000025156 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL31 | ||
| Ensembl ID: | ENSMODG00000001704 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L31 [Source:HGNC Symbol;Acc:10334] |
| Percent Identity: | 56.63 % |
| Parental protein coverage: | 64.8 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | AINEVVTREYTINIHKR-IHGVGFKKRAPRA-LKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYR |
| AI..VV...Y.INIH.R.IH.V.F....P...LKE..KF.MKEMGT....IDT..NKAV.AKGIRN..Y. | |
| Retrocopy | AIDGVVPKQYIINIHFR<IHEVAFNQSVPEV<LKETPKFLMKEMGTSEMFIDTHCNKAV*AKGIRNASYH |
| Parental | IRVRLSRKRNEDE |
| I.V.L..K.N.DE | |
| Retrocopy | IWVHLFEKHNKDE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |