RetrogeneDB ID: | retro_mdom_1361 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 4:140345241..140345579(-) | ||
| Located in intron of: | ENSMODG00000002847 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPL47 | ||
| Ensembl ID: | ENSMODG00000021301 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L47 [Source:HGNC Symbol;Acc:16652] |
| Percent Identity: | 82.46 % |
| Parental protein coverage: | 50.45 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | EKVTESMDALDKVVQERDDALRLLQTGQEYPRPGDWRKDIFGHIIWYK-YKQWPIPWYLNKRYTKKKYFT |
| EKVTESMDALDKVVQERDDALRL.QTGQE..RPGDWRKDIF.HIIWYK..KQWPIPWYLNK.Y..K.YFT | |
| Retrocopy | EKVTESMDALDKVVQERDDALRLPQTGQERSRPGDWRKDIFEHIIWYK<VKQWPIPWYLNKSYNRKTYFT |
| Parental | MPFVDKFVRLRLEKYLRSETKKKNLKRRKEKILQRKFPHMSAEA |
| .P.V..FVRLRLEKYL..E.KKK.LKRR.EKILQRKFPHMS.EA | |
| Retrocopy | VPYVNQFVRLRLEKYLHNEAKKKSLKRRNEKILQRKFPHMSSEA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000011380 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000002312 | 2 retrocopies | |
| Felis catus | ENSFCAG00000031548 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012649 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000021301 | 3 retrocopies |
retro_mdom_1361 , retro_mdom_1879, retro_mdom_562,
|
| Mustela putorius furo | ENSMPUG00000017214 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000037531 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016957 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000004284 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011639 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000006898 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008909 | 1 retrocopy |