RetrogeneDB ID: | retro_itri_829 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393330.1:3931329..3931575(+) | ||
| Located in intron of: | ENSSTOG00000002230 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS15A | ||
| Ensembl ID: | ENSSTOG00000025222 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S15a [Source:HGNC Symbol;Acc:10389] |
| Percent Identity: | 82.93 % |
| Parental protein coverage: | 63.08 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | TVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSA |
| .VMMKHGYIGEFEI.DDHRAGKIVV.LT.RLNKCG.ISPRF.VQL.DLEK.QNNL.PS.QFG.IVLTTSA | |
| Retrocopy | SVMMKHGYIGEFEIMDDHRAGKIVVTLTSRLNKCGMISPRFYVQLRDLEKCQNNLFPSHQFGCIVLTTSA |
| Parental | GIMDHEEARRKH |
| GI.D.EEA.RKH | |
| Retrocopy | GIIDYEEAGRKH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |