RetrogeneDB ID: | retro_cpor_636 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_20:33933472..33933681(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS15A | ||
| Ensembl ID: | ENSCPOG00000021695 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.46 % |
| Parental protein coverage: | 53.85 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | DHRAGK-IVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGG |
| DHRAGK.IVVNLTGR.NKC.VI.P..DVQLKDLEKWQ.NLLPS..F.FI..T.SAGIMDHEEA..KHTG. | |
| Retrocopy | DHRAGK<IVVNLTGRVNKCRVIGPMCDVQLKDLEKWQKNLLPSCHFDFIIQTNSAGIMDHEEAGQKHTGR |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 59 .47 RPM |
| SRP017611_kidney | 0 .00 RPM | 116 .52 RPM |
| SRP017611_liver | 0 .00 RPM | 81 .96 RPM |
| SRP040447_lung | 0 .00 RPM | 209 .71 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 193 .63 RPM |