RetrogeneDB ID: | retro_dnov_2355 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_67070:8081..8277(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS15A | ||
| Ensembl ID: | ENSDNOG00000008341 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S15a [Source:HGNC Symbol;Acc:10389] |
| Percent Identity: | 71.83 % |
| Parental protein coverage: | 52.31 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 3 |
| Parental | KIVVNLTGRLNKCGVISPRFDVQLKDLEK-WQNNLLPS-RQFGFIVLTTSAGIMDH-EEARRKHTGGKIL |
| ..VV.LTG...K..VISPRFDVQLKDLEK..QNNLLPS..QFGF.VLT.S.GIMD...EAR.KHTG.KIL | |
| Retrocopy | QVVVKLTG---K*RVISPRFDVQLKDLEK>RQNNLLPS<CQFGFFVLTISTGIMDQ>KEAR*KHTGKKIL |
| Parental | G |
| G | |
| Retrocopy | G |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 146 .24 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 57 .32 RPM |
| SRP012922_heart | 0 .00 RPM | 78 .19 RPM |
| SRP012922_kidney | 0 .00 RPM | 165 .10 RPM |
| SRP012922_liver | 0 .00 RPM | 76 .32 RPM |
| SRP012922_lung | 0 .00 RPM | 224 .05 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 94 .16 RPM |
| SRP012922_spleen | 0 .34 RPM | 232 .70 RPM |