RetrogeneDB ID:

retro_hsap_164

Retrocopy
location
Organism:Human (Homo sapiens)
Coordinates:1:62656347..62656600(+)
Located in intron of:None
Retrocopy
information
Ensembl ID:ENSG00000234088
Aliases:None
Status:KNOWN_PSEUDOGENE
Parental gene
information
Parental gene summary:
Parental gene symbol:RPS15A
Ensembl ID:ENSG00000134419
Aliases:RPS15A, S15a
Description:ribosomal protein S15a [Source:HGNC Symbol;Acc:10389]


Retrocopy-Parental alignment summary:






>retro_hsap_164
ATTGGCAAATTTGAGGTCATCGATGATCACAGAGCTGGGAAAATTGTTGAGAATCTCTCAGACAAGGTTACACAAGTGTG
CAGTGATCAGGCCCAGATTCGACATATAACTCAAAGATCTAGAAAAATGGCAGAATAATCTCTTCCCTTCCCCTCTGTTT
GGTTTCATTGTACTGACAACCTCACCTGACATCATGGGCCATGAAGAAGCAAAATGAAAACACACAGCGAGTAAAATCCT
GGAATTCTTTTTC

ORF - retro_hsap_164 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: 74.12 %
Parental protein coverage: 64.62 %
Number of stop codons detected: 2
Number of frameshifts detected 1


Retrocopy - Parental Gene Alignment:

ParentalIGEFEIIDDHRAGKIVVNLTG-RLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEE
IG.FE.IDDHRAGKIV.NL...RL.KC.VI.PRFD..LKDLEKWQNNL.PS..FGFIVLTTS..IM.HEE
RetrocopyIGKFEVIDDHRAGKIVENLSD>RLHKCAVIRPRFDI*LKDLEKWQNNLFPSPLFGFIVLTTSPDIMGHEE
ParentalARRKHTGGKILGFFF
A..KHT..KIL.FFF
RetrocopyAK*KHTASKILEFFF

Legend:
*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide






(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)

Expression validation based on RNA-Seq data:
Library Retrocopy expression Parental gene expression
bodymap2_adipose 0 .00 RPM 200 .61 RPM
bodymap2_adrenal 0 .00 RPM 353 .30 RPM
bodymap2_brain 0 .00 RPM 50 .30 RPM
bodymap2_breast 0 .00 RPM 192 .84 RPM
bodymap2_colon 0 .00 RPM 301 .02 RPM
bodymap2_heart 0 .00 RPM 80 .56 RPM
bodymap2_kidney 0 .00 RPM 127 .62 RPM
bodymap2_liver 0 .00 RPM 134 .30 RPM
bodymap2_lung 0 .00 RPM 361 .23 RPM
bodymap2_lymph_node 0 .00 RPM 417 .96 RPM
bodymap2_ovary 0 .00 RPM 398 .88 RPM
bodymap2_prostate 0 .00 RPM 417 .43 RPM
bodymap2_skeletal_muscle 0 .00 RPM 229 .60 RPM
bodymap2_testis 0 .06 RPM 192 .89 RPM
bodymap2_thyroid 0 .00 RPM 171 .65 RPM
bodymap2_white_blood_cells 0 .00 RPM 528 .11 RPM
RNA Polymerase II actvity near the 5' end of retro_hsap_164 was not detected
No EST(s) were mapped for retro_hsap_164 retrocopy.
No TSS is located nearby retro_hsap_164 retrocopy 5' end.
retro_hsap_164 was not experimentally validated.

Retrocopy orthology:
Retrocopy retro_hsap_164 has 1 orthologous retrocopies within eutheria group .

Species RetrogeneDB ID
Gorilla gorilla retro_ggor_248

Parental genes homology:
Parental genes homology involve 21 parental genes, and 288 retrocopies.

Species Parental gene accession Retrocopies number
Ailuropoda melanoleuca ENSAMEG0000001108318 retrocopies
Bos taurus ENSBTAG000000207335 retrocopies
Callithrix jacchus ENSCJAG000000200716 retrocopies
Cavia porcellus ENSCPOG0000002169512 retrocopies
Dasypus novemcinctus ENSDNOG0000000834145 retrocopies
Dipodomys ordii ENSDORG000000015575 retrocopies
Equus caballus ENSECAG000000192932 retrocopies
Homo sapiens ENSG00000134419 37 retrocopies
Gorilla gorilla ENSGGOG0000002629932 retrocopies
Gadus morhua ENSGMOG000000058621 retrocopy
Latimeria chalumnae ENSLACG000000114761 retrocopy
Loxodonta africana ENSLAFG0000002699613 retrocopies
Microcebus murinus ENSMICG0000001224120 retrocopies
Macaca mulatta ENSMMUG000000055933 retrocopies
Oryctolagus cuniculus ENSOCUG0000000017925 retrocopies
Otolemur garnettii ENSOGAG0000001319914 retrocopies
Pongo abelii ENSPPYG000000071392 retrocopies
Pan troglodytes ENSPTRG000000078232 retrocopies
Pteropus vampyrus ENSPVAG0000000290114 retrocopies
Rattus norvegicus ENSRNOG000000183205 retrocopies
Ictidomys tridecemlineatus ENSSTOG0000002522226 retrocopies

Expression level across human populations :
image/svg+xml GBR_HG00142 GBR_HG00099 GBR_HG00114 GBR_HG00143 GBR_HG00131 GBR_HG00137 GBR_HG00133 GBR_HG00119 GBR_HG00111 GBR_HG00134 FIN_HG00378 FIN_HG00338 FIN_HG00349 FIN_HG00375 FIN_HG00315 FIN_HG00277 FIN_HG00328 FIN_HG00321 FIN_HG00377 FIN_HG00183 TSI_NA20756 TSI_NA20538 TSI_NA20798 TSI_NA20532 TSI_NA20765 TSI_NA20518 TSI_NA20513 TSI_NA20512 TSI_NA20771 TSI_NA20786 YRI_NA19114 YRI_NA19099 YRI_NA18870 YRI_NA18907 YRI_NA19223 YRI_NA19214 YRI_NA18916 YRI_NA19093 YRI_NA19118 YRI_NA19213 Toscaniin Italia: Finnish inFinland: British in England and Scotland: Utah Residents (CEPH) with Northernand Western European Ancestry: Yoruba in Ibadan, Nigeria: CEU_NA12760 CEU_NA12827 CEU_NA12872 CEU_NA12751 CEU_NA12873 CEU_NA12400 CEU_NA11930 CEU_NA12004 CEU_NA11831 CEU_NA11843 No expression ( = 0 RPM ) Legend:


Library Retrogene expression
CEU_NA11831 0 .00 RPM
CEU_NA11843 0 .00 RPM
CEU_NA11930 0 .00 RPM
CEU_NA12004 0 .00 RPM
CEU_NA12400 0 .00 RPM
CEU_NA12751 0 .00 RPM
CEU_NA12760 0 .00 RPM
CEU_NA12827 0 .00 RPM
CEU_NA12872 0 .00 RPM
CEU_NA12873 0 .00 RPM
FIN_HG00183 0 .00 RPM
FIN_HG00277 0 .00 RPM
FIN_HG00315 0 .00 RPM
FIN_HG00321 0 .00 RPM
FIN_HG00328 0 .00 RPM
FIN_HG00338 0 .00 RPM
FIN_HG00349 0 .00 RPM
FIN_HG00375 0 .00 RPM
FIN_HG00377 0 .00 RPM
FIN_HG00378 0 .00 RPM
GBR_HG00099 0 .00 RPM
GBR_HG00111 0 .00 RPM
GBR_HG00114 0 .00 RPM
GBR_HG00119 0 .00 RPM
GBR_HG00131 0 .00 RPM
GBR_HG00133 0 .00 RPM
GBR_HG00134 0 .00 RPM
GBR_HG00137 0 .00 RPM
GBR_HG00142 0 .00 RPM
GBR_HG00143 0 .00 RPM
TSI_NA20512 0 .00 RPM
TSI_NA20513 0 .00 RPM
TSI_NA20518 0 .00 RPM
TSI_NA20532 0 .00 RPM
TSI_NA20538 0 .00 RPM
TSI_NA20756 0 .00 RPM
TSI_NA20765 0 .00 RPM
TSI_NA20771 0 .00 RPM
TSI_NA20786 0 .00 RPM
TSI_NA20798 0 .00 RPM
YRI_NA18870 0 .00 RPM
YRI_NA18907 0 .00 RPM
YRI_NA18916 0 .00 RPM
YRI_NA19093 0 .00 RPM
YRI_NA19099 0 .00 RPM
YRI_NA19114 0 .00 RPM
YRI_NA19118 0 .00 RPM
YRI_NA19213 0 .00 RPM
YRI_NA19214 0 .00 RPM
YRI_NA19223 0 .00 RPM


Indel association:

The presence of retro_hsap_164 across human populations is associated with 3 indels. The percentage values indicate the frequencies of retro_hsap_164 presence in various populations. Based on Kabza et al. 2015 (PubMed).


# Indel coordinates AFR, African AMR, Ad Mixed American EUR, European EAS, East Asian
ASW YRI LWK MXL PUR CLM CEU IBS GBR FIN TSI JPT CHB CHS
1. 1:62654000..62657100 98.36 100 97.94 81.82 95.45 90 96.47 100 97.19 96.24 96.94 61.8 65.46 66
2. 1:62654661..62657800 100 100 97.94 86.36 96.36 90.83 96.47 100 97.75 96.24 96.94 71.91 76.29 75
3. 1:62654736..62657200 98.36 100 97.94 81.82 95.45 90 96.47 100 97.19 96.24 96.94 60.11 65.46 65.5


Indel #1, located at the genomic coordinates 1:62654000..62657100.

image/svg+xml Mexican Ancestryfrom Los Angeles USA MXL 81.82 % Puerto Ricansfrom Puerto Rico PUR 95.45 % Colombians fromMedellin, Colombia CLM 90 % Americans of AfricanAncestry in SW USA ASW 98.36 % Yoruba in Ibadan,Nigeria YRI 100 % Luhya in Webuye,Kenya LWK 97.94 % Utah Residents (CEPH)with Northern andWestern European Ancestry CEU 96.47 % Iberian Populationin Spain IBS 100 % British in Englandand Scotland GBR 97.19 % Finnish in Finland FIN 96.24 % Toscani in Italia TSI 96.94 % Han Chinese in Bejing,China CHB 65.46 % Japanese in Tokyo,Japan 61.8 % Southern Han Chinese CHS 66 % JPT EUROPE AMERICAS AFRICA EAST ASIA


Indel #2, located at the genomic coordinates 1:62654661..62657800.

image/svg+xml Mexican Ancestryfrom Los Angeles USA MXL 86.36 % Puerto Ricansfrom Puerto Rico PUR 96.36 % Colombians fromMedellin, Colombia CLM 90.83 % Americans of AfricanAncestry in SW USA ASW 100 % Yoruba in Ibadan,Nigeria YRI 100 % Luhya in Webuye,Kenya LWK 97.94 % Utah Residents (CEPH)with Northern andWestern European Ancestry CEU 96.47 % Iberian Populationin Spain IBS 100 % British in Englandand Scotland GBR 97.75 % Finnish in Finland FIN 96.24 % Toscani in Italia TSI 96.94 % Han Chinese in Bejing,China CHB 76.29 % Japanese in Tokyo,Japan 71.91 % Southern Han Chinese CHS 75 % JPT EUROPE AMERICAS AFRICA EAST ASIA


Indel #3, located at the genomic coordinates 1:62654736..62657200.

image/svg+xml Mexican Ancestryfrom Los Angeles USA MXL 81.82 % Puerto Ricansfrom Puerto Rico PUR 95.45 % Colombians fromMedellin, Colombia CLM 90 % Americans of AfricanAncestry in SW USA ASW 98.36 % Yoruba in Ibadan,Nigeria YRI 100 % Luhya in Webuye,Kenya LWK 97.94 % Utah Residents (CEPH)with Northern andWestern European Ancestry CEU 96.47 % Iberian Populationin Spain IBS 100 % British in Englandand Scotland GBR 97.19 % Finnish in Finland FIN 96.24 % Toscani in Italia TSI 96.94 % Han Chinese in Bejing,China CHB 65.46 % Japanese in Tokyo,Japan 60.11 % Southern Han Chinese CHS 65.5 % JPT EUROPE AMERICAS AFRICA EAST ASIA







Copyright © RetrogeneDB 2014-2017