RetrogeneDB ID: | retro_itri_1228 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393408.1:2388235..2388471(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMEM50A | ||
| Ensembl ID: | ENSSTOG00000022246 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 50A [Source:HGNC Symbol;Acc:30590] |
| Percent Identity: | 53.01 % |
| Parental protein coverage: | 51.59 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | WWIIIDAAVMYPTMEEFNHSYHACGVIATIAFLMINAVSNGQVR-GDSYSEGCLGQTG-ARIWLFLGFML |
| W..I.DAA..YPT..EFN...H..........L.IN.V.......GDSYSEGCLGQTG...IWLF.GFML | |
| Retrocopy | WLVIMDAAIIYPTVGEFN---HS*PAYIVLWHLTINVVTDDFTSLGDSYSEGCLGQTG<TGIWLFAGFML |
| Parental | AFGSLITSMWILF |
| .FGSLI..M..L. | |
| Retrocopy | VFGSLIALMYCLW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000018575 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012615 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000007483 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002060 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000032217 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001182 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001711 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000022246 | 2 retrocopies |
retro_itri_1228 , retro_itri_1329,
|
| Ictidomys tridecemlineatus | ENSSTOG00000023740 | 1 retrocopy |