RetrogeneDB ID: | retro_mmul_1408 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 19:58171676..58172046(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMEM50A | ||
| Ensembl ID: | ENSMMUG00000032217 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 50A [Source:RefSeq peptide;Acc:NP_001248174] |
| Percent Identity: | 57.48 % |
| Parental protein coverage: | 77.71 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MSGFLEGLRCSE--CIDWGEKRNTIASIAAGVLFFTGWWIII-DAAVIYPTMKDFNHSYHACGVIAT-IA |
| M.GFL......E..CIDWGE.RN..AS...G.LFFTG.W.I..DAAV.Y......NH..H.CGV..T.I. | |
| Retrocopy | MAGFLDNFHWPEYECIDWGERRNAVASVVTGILFFTG-WWIM<DAAVVYRRPEQLNHAFHTCGVFPT<IG |
| Parental | FLMI-NAVSNGQVRGDSYSEGCLGQTGARIWLFIGFMLAFGSLIASMWILFGGYVAK |
| FL...NAVSN.QV..DS...GC.G.TGA..WLFIGF...FG.LIASMWILFG.YV.. | |
| Retrocopy | FLHNKNAVSNAQVTDDSCERGC*GRTGAWVWLFIGFVSMFGVLIASMWILFGAYVTQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 56 .25 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 43 .16 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 49 .85 RPM |
| SRP007412_heart | 0 .18 RPM | 33 .03 RPM |
| SRP007412_kidney | 0 .00 RPM | 46 .36 RPM |
| SRP007412_liver | 0 .04 RPM | 12 .51 RPM |
| SRP007412_testis | 0 .04 RPM | 32 .91 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2066 |
| Pan troglodytes | retro_ptro_1379 |
| Gorilla gorilla | retro_ggor_1487 |
| Pongo abelii | retro_pabe_1679 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000018575 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012615 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000007483 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002060 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000032217 | 1 retrocopy |
retro_mmul_1408 ,
|
| Ochotona princeps | ENSOPRG00000001182 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001711 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000022246 | 2 retrocopies |