RetrogeneDB ID: | retro_ggor_3060 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | X:128191044..128191360(-) | ||
| Located in intron of: | ENSGGOG00000007569 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TXNL4A | ||
| Ensembl ID: | ENSGGOG00000005285 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.3 % |
| Parental protein coverage: | 74.65 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 3 |
| Parental | DRVVVIRFGHDWDPTCMKMDE-VLYSIAEKVKNFAVIYLVDITEVPDFNK-MYE-LYDPCTVMFFFRNKH |
| DR.V.I.FGH.WDPT.M.M.E.VLY.IAEKVKN..VIYL.DITEV..FNK.MYE.LYD.C.V.F.F.NKH | |
| Retrocopy | DRGVIIWFGHNWDPTFMNMNE<VLYCIAEKVKNVVVIYL-DITEVLYFNK>MYE>LYDLCIVIFLFGNKH |
| Parental | IMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRG |
| IMI...............DKQEMV.IIETVY.G.RK.RG | |
| Retrocopy | IMILT*LLATTRLTGPQKDKQEMVNIIETVY*GPRKERG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 45 .27 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 24 .43 RPM |
| SRP007412_heart | 0 .00 RPM | 28 .74 RPM |
| SRP007412_kidney | 0 .04 RPM | 41 .62 RPM |
| SRP007412_liver | 0 .00 RPM | 24 .43 RPM |
| SRP007412_testis | 0 .00 RPM | 34 .60 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4900 |
| Macaca mulatta | retro_mmul_2636 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010130 | 2 retrocopies | |
| Homo sapiens | ENSG00000141759 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005285 | 2 retrocopies |
retro_ggor_1731, retro_ggor_3060 ,
|
| Loxodonta africana | ENSLAFG00000003190 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009188 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001613 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008378 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000034753 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010136 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017596 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000022277 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009428 | 1 retrocopy |