RetrogeneDB ID: | retro_cjac_2805 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 6:38551504..38551907(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TXNL4A | ||
| Ensembl ID: | ENSCJAG00000010130 | ||
| Aliases: | None | ||
| Description: | thioredoxin-like 4A [Source:HGNC Symbol;Acc:30551] |
| Percent Identity: | 69.23 % |
| Parental protein coverage: | 99.3 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFN |
| MS..L.HLH..WQVDQ.IL.EED..VVIRF..DWD.TCMKMD.VLYSI.EKVK.FAVI.LVDIT.VPDFN | |
| Retrocopy | MSHTLLHLHSSWQVDQPILPEEDHMVVIRFCNDWDSTCMKMDKVLYSIIEKVKDFAVIFLVDITKVPDFN |
| Parental | KMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKG-RGLVVSPK-DYST |
| KMYELYDPCT.....RNKHIMI.LGTG..NKINWA.EDKQEMVDI.......A..G.R.LV...K..YS. | |
| Retrocopy | KMYELYDPCTI----RNKHIMIVLGTG--NKINWALEDKQEMVDIRGIMDHRAFNG<RHLVMPSK<NYSM |
| Parental | KYR |
| KY. | |
| Retrocopy | KYK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 6 .61 RPM |
| SRP051959_heart | 0 .02 RPM | 6 .51 RPM |
| SRP051959_kidney | 0 .02 RPM | 7 .17 RPM |
| SRP051959_liver | 0 .02 RPM | 7 .06 RPM |
| SRP051959_lung | 0 .99 RPM | 5 .25 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 7 .12 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 11 .79 RPM |
| SRP051959_spleen | 0 .00 RPM | 6 .66 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_1663 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010130 | 2 retrocopies |
retro_cjac_2805 , retro_cjac_3659,
|
| Homo sapiens | ENSG00000141759 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005285 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000003190 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009188 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001613 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008378 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000034753 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010136 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017596 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000022277 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009428 | 1 retrocopy |