RetrogeneDB ID: | retro_ecab_130 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 1:59208650..59209096(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RBM3 | ||
| Ensembl ID: | ENSECAG00000024257 | ||
| Aliases: | None | ||
| Description: | RNA binding motif (RNP1, RRM) protein 3 [Source:HGNC Symbol;Acc:9900] |
| Percent Identity: | 75.33 % |
| Parental protein coverage: | 95.51 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNGES-LDGR |
| K.FVGG..F.TD.QAL.D.FSSFGPISEVVV.KD.ETQ.S.GFGFITFT.P..ASDA.RA.NGES.LDG. | |
| Retrocopy | KVFVGGRGFSTDGQALDDRFSSFGPISEVVVLKDQETQQSWGFGFITFTHPQRASDATRALNGES<LDGC |
| Parental | QIRVDHAGKSARGTRGGAFGAHGRGRGYSRGGGDQGYGSGRYDSRPGGYGYGYGRSRDYGGRNQGGYDRY |
| QI.VDHAGKSA.GTRGGA.GAHGRG.G.SRGGGD.GYGSGRYDS.P.GY.Y.Y.RSRD.GGR.QGGYD.. | |
| Retrocopy | QIPVDHAGKSAQGTRGGALGAHGRGHGQSRGGGDLGYGSGRYDSGPEGYRYRYRRSRD*GGRSQGGYDCD |
| Parental | SGGNYRDNYD |
| .GGN.R.NY. | |
| Retrocopy | TGGNNRANYN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .06 RPM | 231 .34 RPM |
| SRP021940_cerebellum | 0 .16 RPM | 114 .10 RPM |
| SRP021940_embryo | 0 .03 RPM | 183 .38 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 106 .66 RPM |
| SRP021940_synovial_membrane | 0 .16 RPM | 165 .01 RPM |
| SRP021940_testis | 0 .00 RPM | 40 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000013718 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000012653 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000025848 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000000182 | 1 retrocopy | |
| Equus caballus | ENSECAG00000024257 | 2 retrocopies |
retro_ecab_130 , retro_ecab_589,
|
| Homo sapiens | ENSG00000102317 | 1 retrocopy | |
| Gadus morhua | ENSGMOG00000012137 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007003 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003996 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031167 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000007841 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000020314 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021864 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000015630 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021591 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027493 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008670 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008587 | 3 retrocopies |