RetrogeneDB ID: | retro_dnov_952 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_12620:11817..12267(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TCEA1 | ||
| Ensembl ID: | ENSDNOG00000013799 | ||
| Aliases: | None | ||
| Description: | transcription elongation factor A (SII), 1 [Source:HGNC Symbol;Acc:11612] |
| Percent Identity: | 73.86 % |
| Parental protein coverage: | 50.33 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | EPTMTSQNSPEAREESSSSGNVSSRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIAI |
| EP...S..S....EES.SS.N.SSRKDETN.RDTY.SSFP.A.STSDSV.L..R..LAA.L.TGDDYI.I | |
| Retrocopy | EPAVRSEESANV*EESRSSDNESSRKDETNTRDTYLSSFPQAASTSDSVPLMWRDVLAAGLGTGDDYITI |
| Parental | GA-DEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPD-LFARMTAEEMA |
| G...EE.LGSQIEEAIYQ.IRNTDMKYKNRV.SRISNLKDAKN.NL.KNVLCGNIP.D.L.ARM.AEEMA | |
| Retrocopy | GK>EEE-LGSQIEEAIYQKIRNTDMKYKNRV*SRISNLKDAKNLNLGKNVLCGNIPSD<LLARMMAEEMA |
| Parental | SDELKEMRKNLTK |
| .DELK.M.K.LTK | |
| Retrocopy | FDELKHMSKILTK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 22 .17 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 14 .98 RPM |
| SRP012922_heart | 0 .00 RPM | 7 .89 RPM |
| SRP012922_kidney | 0 .00 RPM | 17 .25 RPM |
| SRP012922_liver | 0 .00 RPM | 12 .69 RPM |
| SRP012922_lung | 0 .00 RPM | 29 .02 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 5 .54 RPM |
| SRP012922_spleen | 0 .00 RPM | 32 .96 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001247 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014407 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000013799 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000009220 | 1 retrocopy | |
| Homo sapiens | ENSG00000187735 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023652 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000016022 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000033813 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000981 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007474 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000018589 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020251 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000022323 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000013661 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021179 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000001030 | 1 retrocopy |