RetrogeneDB ID: | retro_cpor_1471 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_9:28954361..28954568(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UBA52 | ||
| Ensembl ID: | ENSCPOG00000000351 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.52 % |
| Parental protein coverage: | 55.47 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | DTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYN |
| DTI.NVK.KIQD.EG..PDQQ.LI.A.K.....R....YNIQKESTL.L.L...GGI...S...L..... | |
| Retrocopy | DTIKNVKIKIQDEEGVSPDQQHLILASKGCRTARLY--YNIQKESTLYLMLHGQGGIVQRSKSALSEAQS |
| Parental | C |
| C | |
| Retrocopy | C |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 77 .01 RPM |
| SRP017611_kidney | 0 .00 RPM | 140 .49 RPM |
| SRP017611_liver | 0 .00 RPM | 86 .66 RPM |
| SRP040447_lung | 0 .00 RPM | 174 .70 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 175 .45 RPM |