RetrogeneDB ID: | retro_btau_775 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 19:63096649..63096892(+) | ||
| Located in intron of: | ENSBTAG00000033680 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPL42 | ||
| Ensembl ID: | ENSBTAG00000002708 | ||
| Aliases: | None | ||
| Description: | 39S ribosomal protein L42, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P82927] |
| Percent Identity: | 71.6 % |
| Parental protein coverage: | 57.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | HPSVDIPYEHTKPIPRPDPVHNNEETHDLVLKTRLEEKSEHLEQGPMIEQLSKMFFTTKHRWYPRGQYHR |
| HPSVDIP..HTKPIPRPDPVH..EETHD.VLKTR.EE.SEH...GP.IE.L..MFF.TKH...PRGQ..R | |
| Retrocopy | HPSVDIPHKHTKPIPRPDPVHDDEETHDAVLKTRSEERSEHSVPGPTIERLGEMFFSTKHHRNPRGQNRR |
| Parental | RRRKLNPPKDR |
| R..KLNPP.DR | |
| Retrocopy | RCKKLNPPEDR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 16 .51 RPM |
| ERP005899_muscle | 0 .00 RPM | 12 .19 RPM |
| SRP017611_brain | 0 .00 RPM | 8 .68 RPM |
| SRP017611_kidney | 0 .00 RPM | 15 .06 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .74 RPM |
| SRP030211_testis | 0 .09 RPM | 57 .69 RPM |