RetrogeneDB ID: | retro_vpac_92 | ||
Retrocopy location | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | GeneScaffold_1734:61409..61720(+) | ||
| Located in intron of: | ENSVPAG00000005680 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TIMM17B | ||
| Ensembl ID: | ENSVPAG00000009578 | ||
| Aliases: | None | ||
| Description: | translocase of inner mitochondrial membrane 17 homolog B (yeast) [Source:HGNC Symbol;Acc:17310] |
| Percent Identity: | 53.33 % |
| Parental protein coverage: | 60.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EEYAREPCPW-RIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSV-AVRIR-ALIGXSFAVWG |
| EEY.RE.CP..R.V.DCGGAF.MG.I..G.FQAIKGF...PVG....L.GS..A...R.......F.V.G | |
| Retrocopy | EEYEREFCPG<RTVEDCGGAFMMGTIDSGDFQAIKGFHHYPVGVNQKLQGSLTAIKTRPPQLEGGFTV*G |
| Parental | GLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAA |
| GL.S..DC.....RGKE..WNS.T..A.TGA..AA | |
| Retrocopy | GLSSMTDCSMAHVRGKEHLWNSVTGAAFTGAMPAA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012474 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000018496 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000008768 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025897 | 2 retrocopies | |
| Felis catus | ENSFCAG00000002569 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000011427 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004174 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005971 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000009148 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004547 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013675 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031158 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007902 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027418 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000007643 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014173 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010396 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000009578 | 1 retrocopy |
retro_vpac_92 ,
|