RetrogeneDB ID: | retro_btau_1550 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 7:104751852..104752249(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BT.79452 | ||
| Ensembl ID: | ENSBTAG00000018496 | ||
| Aliases: | None | ||
| Description: | mitochondrial import inner membrane translocase subunit Tim17-B [Source:RefSeq peptide;Acc:NP_001039953] |
| Percent Identity: | 54.29 % |
| Parental protein coverage: | 79.07 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | GFRNAPVGMRHRLRGSVNAVRIRAPQIGGSFAVW-GGLFSTIDCGLVRLRGKEDPW-NSITSGALTGAVL |
| G....PV...HR.R..V.AV.I.A.QI.G.FA...G.L.ST..CGL..LR.KED.W..S.T.G.LT.AVL | |
| Retrocopy | GLLGGPVETGHRWRRIVTAVSIAALQIAGGFAECRGALISTAACGLLWLRAKEDSW<GSTTRGVLTQAVL |
| Parental | AARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPGQL-PSKEGTPGP-GYPSYQQY |
| A..SGPL.M.G...M.G..L.......ILLTR...QQF..APPFLEDP.QL.P...G.PGP.GYP..QQY | |
| Retrocopy | AVCSGPLNM-GGLVMMGGFLLTL----ILLTRHPTQQFCIAPPFLEDPSQL>PP*GGCPGP>GYPR*QQY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 6 .13 RPM |
| ERP005899_muscle | 0 .00 RPM | 26 .24 RPM |
| SRP017611_brain | 0 .05 RPM | 11 .05 RPM |
| SRP017611_kidney | 0 .00 RPM | 23 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .21 RPM |
| SRP030211_testis | 0 .00 RPM | 11 .50 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012474 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000018496 | 4 retrocopies | |
| Bos taurus | ENSBTAG00000047059 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000008768 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025897 | 2 retrocopies | |
| Felis catus | ENSFCAG00000002569 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000011427 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004174 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005971 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000009148 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004547 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013675 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031158 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007902 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027418 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000007643 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014173 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010396 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000009578 | 1 retrocopy |