RetrogeneDB ID: | retro_vpac_359 | ||
Retrocopy location | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | scaffold_11983:48901..49116(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SLMO2 | ||
| Ensembl ID: | ENSVPAG00000001044 | ||
| Aliases: | None | ||
| Description: | slowmo homolog 2 (Drosophila) [Source:HGNC Symbol;Acc:15892] |
| Percent Identity: | 55.26 % |
| Parental protein coverage: | 52.08 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VQEHSVVDPVEKTMELKSTNISFTNMVSVDERLIYKPHPQDPEKTVLTQEAIITVKGVSLG-SYLEGLMA |
| .QEHS.VD....T.E..ST.I..T......ERL..KPH.QDP.KTVLT..AIITVKG......YL.GLM. | |
| Retrocopy | LQEHSAVDSGDRTVEVTSTDILLTGLEY--ERLTCKPHLQDPGKTVLTHKAIITVKGFTAA<NYL-GLMT |
| Parental | STISSN |
| .TISS. | |
| Retrocopy | NTISSH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |