RetrogeneDB ID: | retro_tsyr_1285 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_380578:1148..1423(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RNF7 | ||
| Ensembl ID: | ENSTSYG00000007778 | ||
| Aliases: | None | ||
| Description: | ring finger protein 7 [Source:HGNC Symbol;Acc:10070] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 82.3 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LASHSGGAGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRV--QVMDACLRCQAENKQEDCVVVWGEC |
| LASH.GGA.SKSGGDKMFSLKKWNAVA.WSW.VECD..AICRV...V.DA.L.....NK..DCVVVW.EC | |
| Retrocopy | LASHFGGAASKSGGDKMFSLKKWNAVALWSWAVECDMGAICRVWTPVLDAKLK---TNKRIDCVVVW*EC |
| Parental | NHSFHNCCMSLWVKQ-NNRCPLCQQD |
| .HSFHNCCMS.WVKQ...RCPLCQQD | |
| Retrocopy | SHSFHNCCMSPWVKQ<DYRCPLCQQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000007694 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000010742 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001991 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005961 | 3 retrocopies | |
| Homo sapiens | ENSG00000114125 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001829 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001353 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006648 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000021232 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000051234 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004646 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000008659 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014167 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000039248 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011663 | 5 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000014964 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000002917 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000007778 | 5 retrocopies |