RetrogeneDB ID: | retro_rnor_624 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 1:182900299..182900633(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rnf7 | ||
| Ensembl ID: | ENSRNOG00000011663 | ||
| Aliases: | None | ||
| Description: | RING-box protein 2 [Source:RefSeq peptide;Acc:NP_001100318] |
| Percent Identity: | 73.04 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | MADVEDGEEPCVLSSHSG-SAGSKSGGD-KMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAEN |
| MA..ED.EEPC..SS.SG...GSK.GG..KMFSLKKW.....W.WDVEC.TCAICRVQVMD.CLRCQAEN | |
| Retrocopy | MANMEDSEEPCIFSSPSG<ETGSK-GGS<KMFSLKKWTTADVWNWDVECNTCAICRVQVMDTCLRCQAEN |
| Parental | KQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK |
| KQED..VVWGECNHSFHNC..SL..K.NN.CPLCQQD.VVQR..K | |
| Retrocopy | KQED*AVVWGECNHSFHNCRVSL*MKPNNCCPLCQQD*VVQRVSK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .14 RPM | 6 .54 RPM |
| SRP017611_kidney | 0 .00 RPM | 14 .44 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .24 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000007694 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000010742 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001991 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005961 | 3 retrocopies | |
| Homo sapiens | ENSG00000114125 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001829 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001353 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006648 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000021232 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000051234 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004646 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000008659 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014167 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000039248 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011663 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019214 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000014964 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000002917 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000007778 | 5 retrocopies |