RetrogeneDB ID: | retro_tbel_2521 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_112506:59471..59712(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS19 | ||
| Ensembl ID: | ENSTBEG00000003457 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S19 [Source:HGNC Symbol;Acc:10402] |
| Percent Identity: | 81.93 % |
| Parental protein coverage: | 56.55 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | VTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTA-RHLYLRGGAGV |
| ..V.DVNQQEFVRALAAFL.KSGKLKVPE.VDTVKLAKHKELAPYDENWFYTRAASTA...L....G.G. | |
| Retrocopy | IPVIDVNQQEFVRALAAFL*KSGKLKVPE*VDTVKLAKHKELAPYDENWFYTRAASTA>LYLWGGAGVG- |
| Parental | GSMTKIYGGRQRN |
| .SMTKIYGGRQRN | |
| Retrocopy | -SMTKIYGGRQRN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |