RetrogeneDB ID: | retro_tbel_1034 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_3626:220806..221000(-) | ||
| Located in intron of: | ENSTBEG00000006335 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM3 | ||
| Ensembl ID: | ENSTBEG00000001050 | ||
| Aliases: | None | ||
| Description: | LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17874] |
| Percent Identity: | 57.58 % |
| Parental protein coverage: | 63.11 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEET-YEEIYKSTKRNFYILFVPVEGRLLVAP |
| .R.D.EL.GR.HAYDQHLNMILG.VEE...TIEIDEE...E.IY.S...N...LFV...G.....P | |
| Retrocopy | IRSDQELQGR*HAYDQHLNMILGYVEEAMVTIEIDEEN<QEKIYESMTCNILMLFVQGDGVPVALP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |