RetrogeneDB ID: | retro_rnor_1304 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 17:43491970..43492340(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Tpi1 | ||
| Ensembl ID: | ENSRNOG00000015290 | ||
| Aliases: | Tpi1, Tpi | ||
| Description: | Triosephosphate isomerase [Source:UniProtKB/Swiss-Prot;Acc:P48500] |
| Percent Identity: | 55.04 % |
| Parental protein coverage: | 51.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | LGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWCKVVLAYEP-VWAIGTGKTATPQQAQEVHEKLR |
| LGV..CIGEKLDEREAGIT..VVFEQT................YE..VWAIGTG.T.TP...QE.....R | |
| Retrocopy | LGVMLCIGEKLDEREAGITKTVVFEQT*FTXXXXXXXXXXIMTYEQ<VWAIGTGTTTTP---QEPRKYMR |
| Parental | GWLKCNVSEGVAQCTRIIYGGSVTGATCKELASQPDVDGFLV-GGASLKPEFVDIINAK |
| ..........V.Q.T.II.GGSVTGATCK.LA..P.VD.FL..GG..LKPE.VDI.N.K | |
| Retrocopy | CYD*NPMCDVVTQITHIISGGSVTGATCKGLAN*PGVDSFLL<GGTPLKPELVDITNDK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .36 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007348 | 2 retrocopies | |
| Homo sapiens | ENSG00000111669 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000002623 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006977 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000024989 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000005194 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000016774 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000023456 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004821 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031254 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004207 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004595 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015290 | 1 retrocopy |
retro_rnor_1304 ,
|
| Rattus norvegicus | ENSRNOG00000050669 | 2 retrocopies |