RetrogeneDB ID: | retro_ptro_43 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 22:23240016..23240250(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSPTRG00000039103 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPTRG00000033768 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 93.75 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | ERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGP-KGFGRGGAESHTFK |
| ERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPY.NH.CYAAMFGP.KGFGRGG.ESHTFK | |
| Retrocopy | ERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYGNHTCYAAMFGPTKGFGRGGPESHTFK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 3 .88 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 2 .08 RPM |
| SRP007412_heart | 0 .61 RPM | 29 .50 RPM |
| SRP007412_kidney | 0 .24 RPM | 9 .99 RPM |
| SRP007412_liver | 0 .10 RPM | 6 .51 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .95 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2550 |
| Gorilla gorilla | retro_ggor_3 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000047229 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
| Homo sapiens | ENSG00000213145 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006209 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001836 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy |
retro_ptro_43 ,
|
| Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |