RetrogeneDB ID: | retro_cjac_163 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 19:17323082..17323316(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000021903 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000019788 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 98.7 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MPKCPKCEKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGG |
| MPKCPKC.KEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGG | |
| Retrocopy | MPKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGG |
| Parental | AESHTFK |
| AESHTFK | |
| Retrocopy | AESHTFK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .04 RPM | 21 .17 RPM |
| SRP051959_heart | 0 .04 RPM | 12 .31 RPM |
| SRP051959_kidney | 0 .00 RPM | 4 .81 RPM |
| SRP051959_liver | 0 .00 RPM | 3 .96 RPM |
| SRP051959_lung | 0 .03 RPM | 16 .01 RPM |
| SRP051959_lymph_node | 0 .11 RPM | 18 .42 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 2 .99 RPM |
| SRP051959_spleen | 0 .04 RPM | 7 .54 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000047229 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019153 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy |
retro_cjac_163 ,
|
| Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
| Homo sapiens | ENSG00000213145 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006209 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |