RetrogeneDB ID: | retro_rnor_2590 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 8:101521747..101521950(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Crip1 | ||
| Ensembl ID: | ENSRNOG00000027990 | ||
| Aliases: | Crip1, Crip, Crp-1 | ||
| Description: | Cysteine-rich protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P63255] |
| Percent Identity: | 56.52 % |
| Parental protein coverage: | 87.01 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | VYFAERVTSLGKDWHRPCLK-CEKCGKTLTSGGHAEHEGKPYCNHP-CYSAMFGPKGFGRGGAESHTFK |
| V......TSLGK..H.P.L..CEK..K.LTS..H.EH.GKPYCN.P.C...MFGPK.FG.GG...H.FK | |
| Retrocopy | VLHSKQMTSLGKG*H*PHLEECEK*QKMLTSWAHTEHDGKPYCNPP<CSIVMFGPKSFG*GGSGLHIFK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 2 .23 RPM |
| SRP017611_kidney | 0 .00 RPM | 4 .95 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .88 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000047229 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
| Homo sapiens | ENSG00000213145 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006209 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000003772 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005041 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies |
retro_rnor_2590 , retro_rnor_2599,
|
| Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |