RetrogeneDB ID: | retro_ptro_1397 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 20:30738516..30738762(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PIGP | ||
| Ensembl ID: | ENSPTRG00000013897 | ||
| Aliases: | None | ||
| Description: | phosphatidylinositol glycan anchor biosynthesis, class P [Source:HGNC Symbol;Acc:3046] |
| Percent Identity: | 86.59 % |
| Parental protein coverage: | 51.9 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | RLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYL |
| RLS.APGKMVENS.SPLPER.IYG..L.LSSQFGFILYLV.AFIPESWLNSLGLTYWPQKYW.VALP.Y. | |
| Retrocopy | RLSQAPGKMVENSLSPLPERPIYGLLLLLSSQFGFILYLV*AFIPESWLNSLGLTYWPQKYWTVALPLYF |
| Parental | LIAIVIGYVLLF |
| LI.IVIGYVLLF | |
| Retrocopy | LITIVIGYVLLF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .22 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .22 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .76 RPM |
| SRP007412_kidney | 0 .00 RPM | 5 .70 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .04 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .96 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2423 |
| Gorilla gorilla | retro_ggor_1508 |
| Pongo abelii | retro_pabe_1787 |
| Macaca mulatta | retro_mmul_624 |