RetrogeneDB ID: | retro_pabe_2733 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5:52595828..52596255(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MAGOH | ||
| Ensembl ID: | ENSPPYG00000001335 | ||
| Aliases: | None | ||
| Description: | mago-nashi homolog, proliferation-associated (Drosophila) [Source:HGNC Symbol;Acc:6815] |
| Percent Identity: | 73.29 % |
| Parental protein coverage: | 99.32 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | ESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITK |
| ES.FYL.YYV.HK.KF.HEF.E.EF.PD.KLR.AN.SNYK..VMIRKEAY..KS.MEELKRII...EITK | |
| Retrocopy | ESNFYLCYYVSHKDKFEHEFPEIEFQPDKKLRCANDSNYKDNVMIRKEAYIYKSMMEELKRIINGNEITK |
| Parental | EDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQD-LKCLVFSLIGLH |
| ..DALWPPPD.....ELEIVIG.EH.SFTTSKIGSLIDV.QSKDPE.LR.FYYLV.D..K.LVF....LH | |
| Retrocopy | *HDALWPPPD---QEELEIVIGHEHVSFTTSKIGSLIDVKQSKDPESLRIFYYLVHD>RKYLVFIVTELH |
| Parental | FKIKPI |
| FKIKPI | |
| Retrocopy | FKIKPI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .73 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 13 .86 RPM |
| SRP007412_heart | 0 .00 RPM | 8 .37 RPM |
| SRP007412_kidney | 0 .00 RPM | 17 .14 RPM |
| SRP007412_liver | 0 .00 RPM | 12 .91 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3318 |
| Pan troglodytes | retro_ptro_2156 |
| Gorilla gorilla | retro_ggor_1303 |
| Callithrix jacchus | retro_cjac_1858 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004538 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000011511 | 1 retrocopy | |
| Homo sapiens | ENSG00000162385 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007594 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000006406 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002444 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017987 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000001880 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000013328 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009020 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001335 | 2 retrocopies |
retro_pabe_1479, retro_pabe_2733 ,
|
| Pan troglodytes | ENSPTRG00000000753 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012778 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001253 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000011611 | 17 retrocopies |