RetrogeneDB ID: | retro_cjac_1902 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 2:37900413..37900756(-) | ||
| Located in intron of: | ENSCJAG00000016159 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MAGOH | ||
| Ensembl ID: | ENSCJAG00000004538 | ||
| Aliases: | None | ||
| Description: | mago-nashi homolog, proliferation-associated (Drosophila) [Source:HGNC Symbol;Acc:6815] |
| Percent Identity: | 84.75 % |
| Parental protein coverage: | 79.45 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | KLRYANNSNYKNDVMIRKEA-YVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISF |
| KLRYANNSNYKNDVMI.KEA.YVH.S.MEELKRIID.SEITK.D..LWPPPDRVGR.E.EIVIGD.HIS. | |
| Retrocopy | KLRYANNSNYKNDVMIKKEA<YVHNSIMEELKRIIDESEITK-DEVLWPPPDRVGRKEFEIVIGDKHISS |
| Parental | TTSKIGSLIDVNQS-KDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI |
| TTSKI.SLIDVN.S.KDPEGL.VFYYLVQDLKCLVFS.I.LHFKIKPI | |
| Retrocopy | TTSKISSLIDVNRS<KDPEGL*VFYYLVQDLKCLVFSIIELHFKIKPI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 7 .28 RPM |
| SRP051959_heart | 0 .02 RPM | 4 .21 RPM |
| SRP051959_kidney | 0 .00 RPM | 5 .70 RPM |
| SRP051959_liver | 0 .00 RPM | 5 .94 RPM |
| SRP051959_lung | 0 .00 RPM | 9 .63 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 10 .89 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 3 .93 RPM |
| SRP051959_spleen | 0 .11 RPM | 10 .21 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004538 | 1 retrocopy |
retro_cjac_1902 ,
|
| Callithrix jacchus | ENSCJAG00000021662 | 7 retrocopies | |
| Cavia porcellus | ENSCPOG00000011511 | 1 retrocopy | |
| Homo sapiens | ENSG00000162385 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007594 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000006406 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002444 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017987 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000001880 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000013328 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009020 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001335 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000000753 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012778 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001253 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000011611 | 17 retrocopies |