RetrogeneDB ID: | retro_pabe_2650 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5:76403905..76404125(+) | ||
| Located in intron of: | ENSPPYG00000015566 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PDCD5 | ||
| Ensembl ID: | ENSPPYG00000009817 | ||
| Aliases: | None | ||
| Description: | programmed cell death protein 5 [Source:RefSeq peptide;Acc:NP_001125439] |
| Percent Identity: | 85.14 % |
| Parental protein coverage: | 58.4 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | RARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEIL-KKVSQQTDKTTTVKFNRRKVMDSDE |
| R.R.SNLALVK..KTKA.ENYLIQM.RYGQLSEKVSE.GLIEIL.KKVS.QT.KTTTVKFNRRKVMDSDE | |
| Retrocopy | RPR*SNLALVKTKKTKAIENYLIQMTRYGQLSEKVSELGLIEIL>KKVSRQTEKTTTVKFNRRKVMDSDE |
| Parental | DDDY |
| D.DY | |
| Retrocopy | DKDY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 24 .77 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 15 .56 RPM |
| SRP007412_heart | 0 .03 RPM | 20 .50 RPM |
| SRP007412_kidney | 0 .00 RPM | 23 .60 RPM |
| SRP007412_liver | 0 .00 RPM | 18 .33 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3194 |
| Pan troglodytes | retro_ptro_2250 |
| Gorilla gorilla | retro_ggor_1334 |
| Macaca mulatta | retro_mmul_2015 |