RetrogeneDB ID: | retro_pabe_2031 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 2a_random:2389429..2389654(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000009694 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.67 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMI |
| MIGDILLFGTLL.NAGAVLNFKLKKKD.QGFG.E..EPSTGDNIREFLLSLRYF.IF..LWNIF.M.CMI | |
| Retrocopy | MIGDILLFGTLLINAGAVLNFKLKKKDMQGFGKEAWEPSTGDNIREFLLSLRYF*IFTILWNIFIMCCMI |
| Parental | VLFGS |
| VLFGS | |
| Retrocopy | VLFGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 22 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .03 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .83 RPM |
| SRP007412_kidney | 0 .00 RPM | 23 .27 RPM |
| SRP007412_liver | 0 .00 RPM | 17 .17 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
| Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
| Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
| Homo sapiens | ENSG00000214046 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009694 | 2 retrocopies |
retro_pabe_1964, retro_pabe_2031 ,
|
| Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |