RetrogeneDB ID: | retro_cjac_1223 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 14:73177217..73177428(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000013936 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.34 % |
| Parental protein coverage: | 68.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MIGDILLFGTLLMNAGAVLNFKLKK-KDTQGFGEESREPSTGDNIREFLLSLRYFR-IFIALWNIFMMFC |
| MI.DILLFG.LLMNAGA.LNFKLKK.KD.QGFG.E....STGDNIREFLLSLRYF...FI.LWN.FMM.. | |
| Retrocopy | MIRDILLFGMLLMNAGAGLNFKLKK<KDMQGFGKEVWKHSTGDNIREFLLSLRYFE<VFIILWNVFMMCY |
| Parental | MIV |
| MI. | |
| Retrocopy | MIM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 5 .64 RPM |
| SRP051959_heart | 0 .00 RPM | 6 .86 RPM |
| SRP051959_kidney | 0 .00 RPM | 7 .61 RPM |
| SRP051959_liver | 0 .00 RPM | 10 .46 RPM |
| SRP051959_lung | 0 .00 RPM | 7 .71 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 6 .32 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 5 .02 RPM |
| SRP051959_spleen | 0 .00 RPM | 7 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy |
retro_cjac_1223 ,
|
| Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
| Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
| Homo sapiens | ENSG00000214046 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009694 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |