RetrogeneDB ID: | retro_cfam_1927 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 8:1038751..1038952(-) | ||
| Located in intron of: | ENSCAFG00000010820 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C19ORF42 | ||
| Ensembl ID: | ENSCAFG00000015643 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.24 % |
| Parental protein coverage: | 90.67 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 0 |
| Parental | LLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNVFMMFCMIVLF |
| LLFG.....A..V.N.KL.K...QGF.EESR..STGDNI.EFL.S.R.FRIFI.L.NVFMM.C.I.LF | |
| Retrocopy | LLFGGC**TARVVFNVKLQKV-MQGFREESR*TSTGDNI*EFLRSFRFFRIFITLGNVFMMSCRIQLF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 18 .65 RPM |
| SRP017611_brain | 0 .00 RPM | 10 .24 RPM |
| SRP017611_kidney | 0 .00 RPM | 32 .29 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .88 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Sus scrofa | retro_sscr_955 |
| Equus caballus | retro_ecab_640 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015643 | 1 retrocopy |
retro_cfam_1927 ,
|
| Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
| Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
| Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
| Homo sapiens | ENSG00000214046 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009694 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |