RetrogeneDB ID: | retro_pabe_1470 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 17:68568479..68568773(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RANBP1 | ||
| Ensembl ID: | ENSPPYG00000011593 | ||
| Aliases: | None | ||
| Description: | RAN binding protein 1 [Source:HGNC Symbol;Acc:9847] |
| Percent Identity: | 65.38 % |
| Parental protein coverage: | 50.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | ANHYITPMMELKPNAGSDRAWVWNTHADFADEC-PKPELLAIRFLNAENAQKFKTKFEECRK-EIEEREK |
| A....TPMM.LKPNA.S.RAWV.NTHADF...C.P.PELLA.RFLNAE.A.KF....E...K..I.ER.K | |
| Retrocopy | ASPKVTPMMKLKPNAVSHRAWVCNTHADFTHGC<PRPELLAGRFLNAEHARKFQSS-ENAKK<DIKERQK |
| Parental | KAGSGKNDHAEKVAEKLEALSV-KEETKEDAEEK |
| K.G.GKN..AEKV.EKLEAL...KEETKED.EEK | |
| Retrocopy | K-GPGKNNNAEKVVEKLEALLL<KEETKEDTEEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 17 .31 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 21 .52 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .21 RPM |
| SRP007412_kidney | 0 .00 RPM | 10 .97 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .03 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010749 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000002962 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011317 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015996 | 2 retrocopies | |
| Homo sapiens | ENSG00000099901 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000784 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016620 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017535 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020100 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010312 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000005732 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005684 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000034333 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000011593 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000001884 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006873 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000026840 | 2 retrocopies |