RetrogeneDB ID: | retro_mdom_1397 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 4:278836078..278836489(-) | ||
| Located in intron of: | ENSMODG00000004859 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000010312 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.71 % |
| Parental protein coverage: | 70.77 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | MDDSNHD-PQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGTI |
| MDDSNHD.P...P..SLPEQEIKTLEEDEEELFKMR.KLF.FASENDLPEWKERGTGDVKLLKHKEKGTI | |
| Retrocopy | MDDSNHD>PSLSPF-SLPEQEIKTLEEDEEELFKMRDKLF*FASENDLPEWKERGTGDVKLLKHKEKGTI |
| Parental | RLLMRRDKTLKICANHYITPL-MELKPNAGSDRAWVWNTHADFADESPKPELLAIRFLNAENAQKFKAKF |
| .LLMR.DKTLKIC.NH.ITP..MELKPN.GSDRA.VWNTH.DFA.ES.KPELLAI.FLNAENAQKFKAKF | |
| Retrocopy | HLLMRWDKTLKICVNHCITPR<MELKPNSGSDRA*VWNTHVDFANESTKPELLAI*FLNAENAQKFKAKF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010749 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000002962 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011317 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015996 | 2 retrocopies | |
| Homo sapiens | ENSG00000099901 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000784 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016620 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017535 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020100 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010312 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000005732 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005684 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000034333 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000011593 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000001884 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006873 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000026840 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000013573 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008142 | 2 retrocopies |